SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6KTI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6KTI1
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.97e-20
Family SMI1/KNR4-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6KTI1
Sequence length 127
Comment (tr|A0A0J6KTI1|A0A0J6KTI1_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KMN39948.1} KW=Complete proteome OX=1628207 OS=Lysinibacillus sp. LK3. GN=VK91_09160 OC=Lysinibacillus.
Sequence
MLPIHNSYTVNPPATDHQIVHIEHRLNCQLPSAYTLVLKESNGLSLMNGVIIYGTEEVIE
RNQTWEVEEYAKGYIAIGDDSGGMVFLMDIKAEDYRVLAVDSGDMNPKHATLITCDFYKW
LQEGCQY
Download sequence
Identical sequences A0A0J6KTI1
WP_048392268.1.17750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]