SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6L321 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6L321
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.93e-22
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6L321
Sequence length 146
Comment (tr|A0A0J6L321|A0A0J6L321_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMN45580.1} KW=Complete proteome OX=1628206 OS=Bacillus sp. LK2. GN=VK90_07670 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRRIKWERTHDPITEQIISEVEEKFNVIFPQDYKNCVMKYNGGHPVPNIFFFEDGEEGVF
DCLLSYTNEYISITVTYDIISPYIPKEIIPFATDPFGNKICFDFRNDKHSPAIVFYDSDE
CDEQAIEYICSTFTNLIDSLHFSENE
Download sequence
Identical sequences A0A0J6L321
WP_048371706.1.100231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]