SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6L9E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6L9E0
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-21
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6L9E0
Sequence length 142
Comment (tr|A0A0J6L9E0|A0A0J6L9E0_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMN45597.1} KW=Complete proteome OX=1628206 OS=Bacillus sp. LK2. GN=VK90_07775 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEKVNWLFTEELIEEKIISKVEKSLGVIFPQDYKECVMKYNGGCPEPDNFNFENGGEGVI
NNLLSFTNQDMNIEMFYDPIQPEIEGIVPFARDPFGNLICFDYRADKLSPTIVFWDHEEQ
GEATIEIICNTFSELLDGLYDE
Download sequence
Identical sequences A0A0J6L9E0
WP_048371742.1.100231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]