SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6NRU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6NRU0
Domain Number 1 Region: 94-223
Classification Level Classification E-value
Superfamily Cyclophilin-like 8.34e-42
Family PH0987 C-terminal domain-like 0.0000322
Further Details:      
 
Domain Number 2 Region: 15-98
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.00000353
Family PH0987 N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6NRU0
Sequence length 231
Comment (tr|A0A0J6NRU0|A0A0J6NRU0_9BACI) Kinase {ECO:0000313|EMBL:KMN41726.1} KW=Complete proteome OX=1628207 OS=Lysinibacillus sp. LK3. GN=VK91_01260 OC=Lysinibacillus.
Sequence
MQPIIDFPHSMWISQHTIRFAFKEEISHSNFHAVQAFNRFLKQQLQHHLIESVASYHTVT
AYIKQKIDIERLRTQWLEMQASTTIDKGTNRLLKIPVCYDEEFALDQKRVMDFTGLPFED
IKTLHMSKSYYVYLIGFLPGFPYLGELDAKLFVPRLQKPRASVSASSVGVGGGQTGIYPV
DSPGGWNIIGKTPLDLFDAHGKEPFLFELGDEVQFYEITKEQFWEMKSKGV
Download sequence
Identical sequences A0A0J6NRU0
WP_048390019.1.17750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]