SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6SAP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6SAP3
Domain Number 1 Region: 64-189
Classification Level Classification E-value
Superfamily Sortase 2.75e-17
Family Sortase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6SAP3
Sequence length 196
Comment (tr|A0A0J6SAP3|A0A0J6SAP3_9RHIZ) Sortase {ECO:0000313|EMBL:KMO30744.1} KW=Complete proteome; Reference proteome OX=1187852 OS=Methylobacterium tarhaniae. GN=VQ03_28165 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MVPWTAGRAVRALAPLLAACGLALVAQGAWIPAKAALAQALLARAFDRSLAEGGPVRPWP
WADTVPVARLALPSLGETYLVLAGASGQALAFGPGQVEGTPDAGEPGTAIYAAHRDTQFR
NLGRLRPGDPVEVRRRDGTTIRFRVTGSRIARWDQSGLDPDAPGRRLVLATCWPLDALVP
GPERLLVEAVADAPRD
Download sequence
Identical sequences A0A0J6SAP3
WP_048454217.1.60536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]