SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6VXE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6VXE7
Domain Number 1 Region: 18-180
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 2.09e-33
Family Chemotaxis phosphatase CheZ 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6VXE7
Sequence length 181
Comment (tr|A0A0J6VXE7|A0A0J6VXE7_9RHIZ) Chemotaxis protein CheZ {ECO:0000313|EMBL:KMO43991.1} KW=Complete proteome; Reference proteome OX=1187852 OS=Methylobacterium tarhaniae. GN=VQ03_05710 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MTSGTETLGSLADSTALLQQHLVAISEAIARTRREIAELRDEQSAGRTRDELHAVVQGTE
HATNTILTASETVDALAGGIARRSGDDATRDDALAIQAQMQTIFEACNFQDLTGQRISKV
VRTIVLVEERVDEMLRVWSGPASAVAAAKPDRRTGEDALLNGPTLPGDASVSQDTVDAMF
P
Download sequence
Identical sequences A0A0J6VXE7
WP_048449902.1.60536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]