SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6YKC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6YKC4
Domain Number 1 Region: 1088-1247
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.28e-24
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 750-922
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.88e-18
Family Pseudo ankyrin repeat 0.047
Further Details:      
 
Domain Number 3 Region: 90-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000132
Family Ankyrin repeat 0.0086
Further Details:      
 
Domain Number 4 Region: 151-200,395-451,483-526,612-638
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000229
Family Ankyrin repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 480-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000301
Family Ankyrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  A0A0J6YKC4
Domain Number - Region: 883-1066
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000932
Family Ankyrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6YKC4
Sequence length 1588
Comment (tr|A0A0J6YKC4|A0A0J6YKC4_COCIT) Uncharacterized protein {ECO:0000313|EMBL:KMP07539.1} KW=Complete proteome; Reference proteome OX=404692 OS=Coccidioides immitis RMSCC 2394. GN=CIRG_07220 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MNNHTFSSRKRLEELAASVGVSMSNYLPILKRNAISSFSHQDKEAAESLATRKRLETFSS
KSHIFRRTPSQRNFKKQELYVAIETVIRENGPVGVLECLVTQAKDAKSKKNIFKTDTQEF
HVGPLLELAIGHRRADMVSILAPQADPASVNSCLRCATASANLDCVKALLENGADPNSCQ
EEFIENITSGNIPLVKLLLRAEKRLNISCLDEALPIVVSKGPLQLVIILLQQGANADSAG
LFESVVEGGRIDLIAAFVSAKRPPSPASLSRALGVVLRGSTVVTEEQRLIIEMLLCAGAS
GENVNKILMRSISTNDGNLASTVVSYREVISYDPSDAIIEAVKKNDMEILSIIFNGKLDS
DCASALLAKFSKVSVTLASSRKLWIVSTLVKYGATGSPLHEYLVNSVQRNDELLVRFLVD
HGASVDYQDAKALRLAMSSKNLQIFKKLLGGKPSQPSFSLCFRLLPTLPPNLQLDLASEL
LAAGAQGQEVDKTLARVFSDNVTLERHQFLELLVRHGADVNIKDGYCFQEAARLGDIVSL
SILLKGSLSELSLCRALTPASKLSPKELRFTIVDLLLSAGARGPIVDAQLVELVQEIPVD
IVLISLVLEKGEANINMDGGKPVHHACRKADYKLLELLLQYRPTTKTLDAAFLTATSLED
PAVRYEICHKLLNAGVKGAMLDKSLICEQQSPSSNMSLLELLIDHGANINFNNGAAIRNA
IKQSDEQQLVLFASRMPSRQTVMGGLELLLRTNTVKRYEMANILLNATDISVSEALNPML
PEVIRLDIRNHRLLKLFIQHGASVDYQQGMAIRKSIDNDYIDACELLLGQPVSSDTLETV
FGSCLAIEGPRRVQYTKLVLQAGFDGRCVDEALLKIVQEKPCDMDMVILLLAHGASVHFA
NSQCIVHAALSRDDLILRIILESVSDKIAVTYAFGKTISAGITWLSASGLPTIELLLRHG
ATGEALNLALIAAVGNAAMNPEVAKFVDLFLEFGARADYHDGRALRAAISKGQISLTKKI
MDTCPSSKSLAIGLTCVFSSDLSEDVSLKLIEILTQNQADVDAVDTLWCSDGLQKESPVL
LCLQKWPRGTKILEKLLQSGMNVNQITSYTIENDHGLEHVSLLLWALLQPKQRISSYAIE
CLLKHGADPNFQSTGSWKSPLLIASIERTPDVVLQLIHHGADVSRGDAAGKTPLFYASRR
NQIDIIRHLIDAGATVDDGSLHEAAQALSPDAVQLLISYGHDPNFPSMLHDGRCALANLS
LHASDARLPVSGIRKTIDALIAGKADLRAQSQGKSLLFHALDNLGACVHVTTALLASGMW
KLINDSCNIFTSNNYVYSPSMYIKKNLQSSPRELGPQLLHILKAHNCRDVYYRLTSPQPP
DMVNAPPEIMAEESRRQARVKRLQDQEEEHQMQLRQNEDLANQQDILMTRTHNLRIQHDR
ELADEREANAERFAKQQLRLDAESAAQRSRLAQQNRMLEFEHTKTLSQLRLQALEQQGRL
QIANAQEVARIEQELVDKKLTTEIQRIRELEAANDRQYKRDADILCRQERLWAERKGIMS
EDRGITPGNASGTMSPVKGLTYQGAELD
Download sequence
Identical sequences A0A0J6YKC4
CIRT_07225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]