SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6YWM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6YWM5
Domain Number 1 Region: 138-281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.16e-55
Family AadK C-terminal domain-like 0.00000378
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.92e-45
Family AadK N-terminal domain-like 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6YWM5
Sequence length 286
Comment (tr|A0A0J6YWM5|A0A0J6YWM5_BACCE) Putative aminoglycoside 6-adenylyltansferase {ECO:0000313|EMBL:KZD76009.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4155_4230 OC=Bacillus cereus group.
Sequence
MRNENEMMSLFENIAMNDDRIRLSVLEGSRTNKNIPKDDFQDYDISFFVSDIESYKKDDY
WLEIFGDLIFMQKPEDMELFPAELGNWFSYIMYFNDGIKIDLTLIPLNEIDQYLSDADGL
VEILIDKDKHINEKIVPNDKKYWIKKPSEREFDDCCNEFWCVSAYIAKGFYRKELFYALD
YFNQILRPELLRMMSWEVGIREGFNFSVGKNHKFIGNYLPEEELEKLIKTFSQSGYKESW
GSFKLCCDMFRAYSKKVASLLDFNYPDYDEKMTDFIQNNYTKLSQE
Download sequence
Identical sequences A0A0F5RIA1 A0A0J6YWM5 A0A0U0IJ70 C2QDZ2
WP_001243408.1.13221 WP_001243408.1.35255 WP_001243408.1.67873 WP_001243408.1.68562 WP_001243408.1.76902 WP_001243408.1.83938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]