SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7B0N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7B0N5
Domain Number 1 Region: 124-211,267-328
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.67e-18
Family SMI1/KNR4-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7B0N5
Sequence length 524
Comment (tr|A0A0J7B0N5|A0A0J7B0N5_COCIT) Glucan synthase-1 {ECO:0000313|EMBL:KMP03347.1} KW=Complete proteome; Reference proteome OX=404692 OS=Coccidioides immitis RMSCC 2394. GN=CIRG_03039 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MTSFGSAWRSFWHTMTSNDRHASHDSPYRTGQHVPLSQSRHAPLTSVATSAIESRPDLSS
SFEEDSSKRSQRWSESQDTITSPTRPYSPGMRSKQRRSNEQDEGVQMQSFHDGAPPPPPV
SHSWRKIDKWCERNYEELFDQLCEGCTQNDVNELEHELDCSLPLEVRESLMIHDGQERGG
LPTGVLFGCMLLDCEEIVQEWRNWRTVNEEFLSTTTISGPQPPLKAYGGSSTSSAAQAQS
NPLWRQELLDRQDSQPVRAIQKAYAHPSWIPVARDWGGNNIAIDLAPGPAGKWGQVILFG
RDYDCKYVIARSWAAFLAMVADDFHSGKVIVDEDSNELRLKPFRNADPPYLEILRWRTDQ
KHGRRPPKKRSGGVGLGVNTSVNGKTTRDSPYGSPTPSTEERGRSPHRFPSRGPNGSPKG
GLALSSPLARVAEEASSPVKENEPNDADKSKSKDADLVDLTSPAASIRAEPVHTTDSKND
GDAEQGTSKRTSKAADKPKSGLSTPRSSTGLDAKDFEGMKSIAI
Download sequence
Identical sequences A0A0J7B0N5 A0A0J8TJK1 A0A0J8UCG3 J3K7R7
CIMG_06246T0 CIRT_03042 CIHT_02728 XP_001242350.2.59393 CIST_03882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]