SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7CDV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7CDV4
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.12e-58
Family AadK C-terminal domain-like 0.0000445
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.54e-50
Family AadK N-terminal domain-like 0.0000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7CDV4
Sequence length 290
Comment (tr|A0A0J7CDV4|A0A0J7CDV4_BACCE) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KMP20977.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CON37_22980 OC=Bacillus cereus group.
Sequence
MRTEKEMLDVIINIAKEDERIRAVIMNGSRVNPNVKRDCFQDYDIMYVVNDIQSFTSNHN
WVHRFGEIMIVQMPEEMSLVQPDEDGKFPYLMQFMDGNRIDLTLVPVELIKKFVGQDSLS
KLLLDKDNCMEGFPPASDKDYLIKKPTEKEFLDCCNEFWWCSTNVAKGLWREELSYAKGM
LEGPVRDMFIVMLEWHIGMKTDFTVNTGKFGKHFEQYIEEDMWEQFKRTFSNAEYENIWE
SFFVMSDLFREVANEIANTYEYQYPQDEDDKVTNYLKHVKALPKDSTSIY
Download sequence
Identical sequences A0A0J7CDV4 A0A243D670 B7HJ86 C2R6N8 R8U8N5
gi|218232233|ref|YP_002366682.1| 405532.BCB4264_A1965 WP_001258539.1.100082 WP_001258539.1.10055 WP_001258539.1.10584 WP_001258539.1.14039 WP_001258539.1.23652 WP_001258539.1.3798 WP_001258539.1.47975 WP_001258539.1.60334 WP_001258539.1.63902 WP_001258539.1.67873 WP_001258539.1.73457 WP_001258539.1.73594 WP_001258539.1.76086 WP_001258539.1.76804 WP_001258539.1.81773 WP_001258539.1.85348 WP_001258539.1.90352 WP_001258539.1.95576 WP_001258539.1.97670 WP_001258539.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]