SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7DC47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7DC47
Domain Number 1 Region: 18-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000667
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7DC47
Sequence length 194
Comment (tr|A0A0J7DC47|A0A0J7DC47_BACCE) SMI1/KNR4 family protein {ECO:0000313|EMBL:KMP76189.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=SAMN04487767_101710 OC=Bacillus cereus group.
Sequence
MINWKEKITTLALVKQDLMKQDVEKIWPHHFPEVGASEEYVYALEQELGYKLDLIYRDFL
QHANGWKGIYQTVDLFSIEQLKKSAIMDHAQMLLTVIDDDVLKESDVLRQELLPIAVAEF
DKDLFVLCLSNSRKPGEIIWFAGEEIDRFENFEEYFLAMVDYNREEILALKGNQLKRELN
FEIPVYKNSSSKKY
Download sequence
Identical sequences A0A0J7DC47 A0A2C4A671
WP_000611507.1.23427 WP_000611507.1.30788 WP_000611507.1.3130 WP_000611507.1.31387 WP_000611507.1.37027 WP_000611507.1.37384 WP_000611507.1.42237 WP_000611507.1.59075 WP_000611507.1.67283 WP_000611507.1.71142 WP_000611507.1.72554 WP_000611507.1.75554 WP_000611507.1.76342 WP_000611507.1.78264 WP_000611507.1.83206 WP_000611507.1.8759 WP_000611507.1.87960 WP_000611507.1.92586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]