SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7EL64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7EL64
Domain Number 1 Region: 61-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000432
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7EL64
Sequence length 173
Comment (tr|A0A0J7EL64|A0A0J7EL64_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KMP92821.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU65_19535 OC=Bacillus cereus group.
Sequence
MKNEMENCFDKIIREWQDCNNSLPKSLWIEEAETFIYEGEPDIKGYVCWKPLEKNIIHDF
SNIEKDLGIQLHNSIKEYYNSYWFLDLGGNYLGYDFELNPVIPGIELHDFYVSLQGYQSA
HDNLLNNIPIGMEFNGLLVVVDNENGQVKLEDYEIGSFEVICDSLAELILNLS
Download sequence
Identical sequences A0A0J7EL64 A0A2C5QJW5
WP_048545570.1.1809 WP_048545570.1.51099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]