SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7EP70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7EP70
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.71e-20
Family SMI1/KNR4-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7EP70
Sequence length 217
Comment (tr|A0A0J7EP70|A0A0J7EP70_BACCE) SMI1/KNR4 family protein {ECO:0000313|EMBL:KMP93765.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU65_16350 OC=Bacillus cereus group.
Sequence
MINLFNIPDLIAKSAASDIEIQAVENRMNVTLPNVYKELLRCTNGFSIGGGLLIYGTEHI
AERNEVWEVDEYARGYVSVGDDGGGNVFLMAQHAEEKEVVVIDSGDMNPSHATVITADFK
KWVNSGCVSEIEQKTIHKSSDICNIVLVKTPNEGLKDLIRIKNVLGLEISAIDLLKGSKN
FPYILVERFPYGKAKKLIEKLAIDSTILSIETTGKNS
Download sequence
Identical sequences A0A0J7EP70
WP_048544670.1.1809 WP_048544670.1.51099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]