SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7FF93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7FF93
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily BAS1536-like 6.67e-16
Family BAS1536-like 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7FF93
Sequence length 57
Comment (tr|A0A0J7FF93|A0A0J7FF93_BACCE) Stage II sporulation protein E {ECO:0000313|EMBL:KMQ03021.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU68_17950 OC=Bacillus cereus group.
Sequence
MNVTKLNDRIEAKKKELIHLVEQYGFTHQKVISFSQELDRLLNLLIEIKTKKKRCSL
Download sequence
Identical sequences A0A0J7FF93
WP_048553499.1.3561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]