SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7FWF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7FWF3
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.01e-32
Family SMI1/KNR4-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7FWF3
Sequence length 132
Comment (tr|A0A0J7FWF3|A0A0J7FWF3_BACCE) Spore coat protein {ECO:0000313|EMBL:KMP72738.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU62_24375 OC=Bacillus cereus group.
Sequence
MGGVNEDTIREAARMLSITFPITYHCFLKQYGSGGLDGMDIHGCETTAADSSVVYHTKLY
RETYNLPEQYIVLNDIDGTVTCLDTNQMKDGECPVVFWSRFSKELYTITYENFSDYLLDS
LHESVDNLYDED
Download sequence
Identical sequences A0A0J7FWF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]