SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7FYV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7FYV2
Domain Number 1 Region: 17-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-22
Family SMI1/KNR4-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7FYV2
Sequence length 177
Comment (tr|A0A0J7FYV2|A0A0J7FYV2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KMP73678.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU62_18150 OC=Bacillus cereus group.
Sequence
MLRKYYSKNNHLQPFFEEVNKYVDGIHNLNNGINLEDITSLQNELNIQIPDIYKDFLQVC
NGGELFIPGTILSEIHTAAQGPKQRGGSYLNDSFKKERRPTKMPDTYLIIADLNYGDSIC
IIDLESSNGYDATVIQWDREIHSVSRSWNGLVEWLMDTLDEGSLLVDYDGNEKDLDF
Download sequence
Identical sequences A0A0J7FYV2
WP_048562105.1.31387 WP_048562105.1.67283 WP_048562105.1.75554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]