SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7H6N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7H6N0
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.37e-24
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7H6N0
Sequence length 150
Comment (tr|A0A0J7H6N0|A0A0J7H6N0_BACCE) SMI1/KNR4 family protein {ECO:0000313|EMBL:KMQ33262.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=COI98_05685 OC=Bacillus cereus group.
Sequence
MNNITWSFMSKTPVTDEEIQKAEQYFNIKLPNDFVACVKKYDGGYPNPKVFDVPGQDENV
FSDLLTLHIEDKYSIVQNYEGIKDRLVDKVYPFARDPFGNLLCFDYRNNPEAPTVVFWDH
EEEEMEEAIYPVCSSFTELLDSLRDFEDDE
Download sequence
Identical sequences A0A0J7H6N0 A0A2A8DNQ0 N1LU11 R8TD85
WP_001060036.1.100082 WP_001060036.1.23652 WP_001060036.1.3798 WP_001060036.1.39957 WP_001060036.1.47975 WP_001060036.1.63902 WP_001060036.1.73594 WP_001060036.1.76804 WP_001060036.1.90352 WP_001060036.1.97993 WP_001060036.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]