SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7I3S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7I3S7
Domain Number 1 Region: 144-283
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.28e-36
Family AadK C-terminal domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.45e-27
Family AadK N-terminal domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7I3S7
Sequence length 287
Comment (tr|A0A0J7I3S7|A0A0J7I3S7_9FLAO) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KMQ60471.1} KW=Complete proteome; Reference proteome OX=885586 OS=Chryseobacterium sp. BLS98. GN=ACM40_11850 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MAVREEKLKQIISWAENNPDIRTVLLTSSLVNPYAPVDDFSDLDIELVFENMKDYEADRK
WIDLFGEPISMLEEDETYFDGKHAMKMVLYTDHVKVDFKLYQKSEFEKEIQEESLPDDWD
VGYKVLIDKDHLTENMKLPTYQSIMIKQPTEKKFRQLMNDFWWDTTYVVKCLKREDLFYA
QFMSGGIRTDYLVPLIEWYIASNHNWENITTNKHGRLFKKYLPEELWRRVEATFSASSIE
ENWRALYATADLVHELGVILAENLKFEYPQKLENDIRKYFDEVRSIP
Download sequence
Identical sequences A0A0J7I3S7
WP_048503010.1.63415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]