SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7IIQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7IIQ6
Domain Number 1 Region: 21-168
Classification Level Classification E-value
Superfamily OmpH-like 1.7e-22
Family OmpH-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7IIQ6
Sequence length 184
Comment (tr|A0A0J7IIQ6|A0A0J7IIQ6_9FLAO) Molecular chaperone Skp {ECO:0000313|EMBL:KMQ65879.1} KW=Complete proteome; Reference proteome OX=1674291 OS=Chryseobacterium sp. FH2. GN=ACM39_15745 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKNFKIVFTFVLFLLFSFGNAQKIGVVDTESILDKLPQYKEAEARLNSQIDTWQSDLQNL
QSEYEKKRSAFENEKVLLVGEQLKLREKEVLDLEKNIKTTTSLRFGANGEITKLRTNLVT
PFQDQIWEAIKAMSEKNGLGIVLDKSNNVNVIFLQPRYDYTDKVLDILLKGNDKNDKAKT
KGKK
Download sequence
Identical sequences A0A0J7IIQ6
WP_048512005.1.73294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]