SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7IIY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7IIY4
Domain Number 1 Region: 22-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.76e-29
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J7IIY4
Sequence length 178
Comment (tr|A0A0J7IIY4|A0A0J7IIY4_9FLAO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KMQ66037.1} KW=Complete proteome OX=558151 OS=Chryseobacterium angstadtii. GN=ACM46_00260 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
METQFFKDFDFTDFWNESSYSVRDYEEPFPDDELIISIEEELGYKLPASYIELMKLHNGG
LVEKSSFPTSESTSWAEDHIGITGIMGIGREKTYSICGELGSQFMIDEWGYPAIGIYICD
CPSAGHDMILLDYSDCGKDGEPKVIHVDQESDYKKTFLAENFEAFIKGLRDEDEFDGE
Download sequence
Identical sequences A0A0J7IIY4
WP_048504640.1.69240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]