SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7JTK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7JTK6
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0000589
Family Tex N-terminal region-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7JTK6
Sequence length 198
Comment (tr|A0A0J7JTK6|A0A0J7JTK6_LASNI) Transcription elongation factor spt-6 {ECO:0000313|EMBL:KMQ81537.1} KW=Complete proteome; Reference proteome OX=67767 OS=Lasius niger (Black garden ant). GN=RF55_26038 OC=Vespoidea; Formicidae; Formicinae; Lasius; Lasius.
Sequence
KVLEFFIVDEVEVPYVFQHRKDYLLHSKKIRRSTRDDPDGPDYTIQSDKLLNQDDLWRIL
ELDVKFRSFVEKRNSLEKTVESLKTVDVEDHMVTEMIPEAVTMEELQDLQDYLQFQYGPR
LKDLAAMSGNVSQTKRPGSKSSLLDRVRNGKAYYFVKAYGISADQLAKNAVRQGKKVAPD
DDEQYPIDLADSLIDDNF
Download sequence
Identical sequences A0A0J7JTK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]