SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7KBV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7KBV5
Domain Number 1 Region: 67-261
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.75e-23
Family Hemopexin-like domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7KBV5
Sequence length 289
Comment (tr|A0A0J7KBV5|A0A0J7KBV5_LASNI) Neutrophil collagenase {ECO:0000313|EMBL:KMQ87767.1} KW=Complete proteome; Reference proteome OX=67767 OS=Lasius niger (Black garden ant). GN=RF55_12866 OC=Vespoidea; Formicidae; Formicinae; Lasius; Lasius.
Sequence
MYAFVPSSGNQFSVKLSIEDILAVQNLYGPKNEKHVSTTTTTIPITTTTIAPTTTTMITP
DNLSDTDLCALRHLDTALILNRRMYIARQHTVWSVSLNERIYGKPMLPDYMRFLPANFTS
LSAVYQRPSGDLALFVDNSIYMVENPSFTLRQGWPQTLADIRLPPNAKINAAINTNTGRT
FVIYDNDKVAEIDECTMMATKHSSLQEIFLGIPSAVTSAFRHIDGNLFFFAKHQFYVFNE
FTNNVIIGGPFDLYALGIECPRNGLLLQVRDLLDRIYRIGDVFASDTTD
Download sequence
Identical sequences A0A0J7KBV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]