SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7KNQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7KNQ9
Domain Number 1 Region: 31-95
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000102
Family Tachycitin 0.003
Further Details:      
 
Domain Number 2 Region: 159-213
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000107
Family Tachycitin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7KNQ9
Sequence length 217
Comment (tr|A0A0J7KNQ9|A0A0J7KNQ9_LASNI) Uncharacterized protein {ECO:0000313|EMBL:KMQ91874.1} KW=Complete proteome; Reference proteome OX=67767 OS=Lasius niger (Black garden ant). GN=RF55_8210 OC=Vespoidea; Formicidae; Formicinae; Lasius; Lasius.
Sequence
MYVFVIALWATWTVISAKELDWELGCPVTKCPFPEKYATNLPHENDCTKFYKCFLGKPIL
QDCPLMIPGDPKKRLHYNRRLQVCDWPWEAGCESCPKVDKNDKCVPPPKISNPEDDCDTY
YECEDGKGKLRRCKDDDTCFSRTCQKCVPNREGGECDGEPIPCENGDRKPHECDCGLYYQ
CRNCEWIKEWCIDGCHFNPETKECEDPDKAGCLKIEE
Download sequence
Identical sequences A0A0J7KNQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]