SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7KWR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7KWR5
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 4.19e-17
Family Taf5 N-terminal domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 162-271
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000311
Family WD40-repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J7KWR5
Sequence length 273
Comment (tr|A0A0J7KWR5|A0A0J7KWR5_LASNI) Taf5-like rna polymerase ii p300 {ECO:0000313|EMBL:KMQ94972.1} KW=Complete proteome; Reference proteome OX=67767 OS=Lasius niger (Black garden ant). GN=RF55_4839 OC=Vespoidea; Formicidae; Formicinae; Lasius; Lasius.
Sequence
MLHAGNRQAANQFLKAHQNEFISDTEKDFLEELSRVFSVQDIELRPLVNAFRTRKYKVDL
SESAHICLRQYLTRYGHIILLQIINTHITIIRKAGSPKMDGETHEEKSQRFETNINGHME
QPSGTGVDREMRELQEAIRLIRNNSHQALRIFTVKNAVENASCGLIAPKMDKLAIGFSTA
EIRLWGIGETVLVKRKNKQTHVPFVCDVSPFYKFNEHESTIRSEAGAIILRGHTDVVHDL
RFIPEADILLSVSSDKDMRAWRLNDYSCAAVYR
Download sequence
Identical sequences A0A0J7KWR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]