SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7L5A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7L5A7
Domain Number 1 Region: 204-258
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000321
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000424
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7L5A7
Sequence length 274
Comment (tr|A0A0J7L5A7|A0A0J7L5A7_LASNI) Tripartite motif-containing protein 9 {ECO:0000313|EMBL:KMQ98127.1} KW=Complete proteome; Reference proteome OX=67767 OS=Lasius niger (Black garden ant). GN=RF55_1516 OC=Vespoidea; Formicidae; Formicinae; Lasius; Lasius.
Sequence
MEDELRCPSCKELFVEPVLLPCWHALCLACAVNLQAPPDSPPESTADSSNAPGSDQEADK
LSILSETDSGVVCSSTSTSSRPGSYVGTPGNGGGFPPSGGTLCLSCPVCQKTVYFDEGGA
HNLPKYWAMQHIVDKYQESRNARLQCQMCEGEPRDATVACEQCEVLYCDACRESCHPKRG
PLAAHNLGPPRGSWQSNGSKGSRPENTPVCNDHNGEAVTLYCALCKIAICALCLRDRHAA
HPHDVLPLAAACKAQKAESKHQTINADIASDGLL
Download sequence
Identical sequences A0A0J7L5A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]