SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8A4D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8A4D7
Domain Number 1 Region: 32-181
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000144
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8A4D7
Sequence length 183
Comment (tr|A0A0J8A4D7|A0A0J8A4D7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KMS82819.1} KW=Complete proteome; Reference proteome OX=68263 OS=Streptomyces regensis. GN=ACZ91_56680 OC=Streptomyces.
Sequence
MDSWDENGIRARIREMAARDPGLVRFGAETHRYKLTPRLPEAEIRAFEESHGIDLPVEYR
SFVAEVGNGPAGPGHGLMPLTVARPEAAEEWAVDAEWWEDRLPGRLAEPFPLTAPLPGRI
DAAADGLTRGTLVLADQGCGIFTRLVLNGPRAGQVWQIDPDWGGFVPVSPGFRAWYTGWL
ASP
Download sequence
Identical sequences A0A0J8A4D7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]