SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8AJ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8AJ42
Domain Number 1 Region: 136-278
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.29e-17
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J8AJ42
Sequence length 315
Comment (tr|A0A0J8AJ42|A0A0J8AJ42_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KMS88521.1} KW=Complete proteome; Reference proteome OX=68263 OS=Streptomyces regensis. GN=ACZ91_25630 OC=Streptomyces.
Sequence
MHFPDPVRAARHPRGVRVDERGHPDFSPYARVAVEIAEPPEGFGVDELRLTDYVSANAAL
AAAGHELWDTVPDVATPHGWTWHHVAGTRRLELVPVEVKALLRHHGGVATAPVDHGKRGT
RPLQESRPAHFGLPKSGVAVTEAQVQGVEEDLGYRLPGAYRSFLKAAGGCAPVGTALDAE
LGLLLDQPFFTVRDEAAVNDLVYVNKCLRDHLTKDYLAVTFVQGGLLAVKVKGERVGSVW
FCAYDDVRDVDPSWSPAERVERLLLPCGDDFDAFLSRLAGSPPELETVAHLMVDGGFARV
VPVSSGSASSGPVGE
Download sequence
Identical sequences A0A0J8AJ42 A0A0L8N7H8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]