SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8B882 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8B882
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.93e-25
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Domain Number 2 Region: 145-202
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000183
Family EB1 dimerisation domain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8B882
Sequence length 231
Comment (tr|A0A0J8B882|A0A0J8B882_BETVU) Uncharacterized protein {ECO:0000313|EMBL:KMS97474.1} OX=3555 OS=Beta vulgaris subsp. vulgaris. GN=BVRB_5g126730 OC=Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta.
Sequence
MMDMTFPGVVPMHKVNFDAKTEYDFIQNYKVLQDVFSKLKIDKHIEVNKLVKARPLDNLE
LLQWLKRYCDSINGGIMNENYDPVERRCKGGKDRSSRTTQKNSKSMQANIMQNCGSDDRV
GPRKTPDLKQEKVHSPNGGVDCTEEIQVLSQEITDLKLSVDLLGKERDFYFGKLRDVEIL
CQASSVPMAVAIKKILYAADEKESALSEAQQVLSESLDSDVVDPEEEKSVD
Download sequence
Identical sequences A0A0J8B882
XP_010695715.1.25731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]