SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8C414 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8C414
Domain Number 1 Region: 115-259
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J8C414
Sequence length 293
Comment (tr|A0A0J8C414|A0A0J8C414_STRVR) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KMS72550.1} KW=Complete proteome; Reference proteome OX=1938 OS=Streptomyces viridochromogenes. GN=ACM01_22410 OC=Streptomyces.
Sequence
MDERGYPDFSPYARAAAEIAEPPQGFGVDELRLTDYVSANAALAASGHELWDTIPAVATP
HGWTWHHVVGSRRLELVPVEVKALLRHHGGIATSAVDHDKRGTRPLQETRPAHFRLPKSG
VAVTEAQALGVEEDLGYRLPGAYRSFLKAAGGCAPVGTALDPGLGLLVDQPLFTVRDEAA
VNDLVYVNKCLRDHLTKDYLGVGFVQGGLLAVKVKGERLGSVWFCAYDDARDVDPSWPPA
ERVERLLVPCGEDFDAFLSRLAGSPPELETVANLMVDGGFAGAVPVAAAAVGE
Download sequence
Identical sequences A0A0J8C414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]