SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8GC09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8GC09
Domain Number 1 Region: 103-220
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000000196
Family AadK C-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000173
Family AadK N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J8GC09
Sequence length 227
Comment (tr|A0A0J8GC09|A0A0J8GC09_9LIST) Uncharacterized protein {ECO:0000313|EMBL:KMT58459.1} KW=Complete proteome OX=1430899 OS=Listeria fleischmannii 1991. GN=X560_2285 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MDKYSDLDLNVWFSKEMDFTNDLTWLSELGEVLVAVPLDFPVQDGMRSLIVIFENGVKVD
FSFWPIEFLEQPFPYYDAYLILLDKANLSEKLVPFLKKSEVTQMDEKAFQTLVDEFYLEM
HYVAKFQKRGEFWFVAALKAGIRENYFLPLLEQIAILEGKSPSFLGRHMNDWLSPFWLNK
IQLLFKENDSKEVFALFSELYQEIARKMDFQFDQKRLKKLENLILGL
Download sequence
Identical sequences A0A0J8GC09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]