SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8I3M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8I3M5
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 7.32e-24
Family Thiamin pyrophosphokinase, catalytic domain 0.0053
Further Details:      
 
Domain Number 2 Region: 132-207
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000157
Family Thiamin pyrophosphokinase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8I3M5
Sequence length 245
Comment (tr|A0A0J8I3M5|A0A0J8I3M5_GARVA) Thiamine pyrophosphokinase {ECO:0000313|EMBL:KMT45931.1} KW=Complete proteome OX=2702 OS=Gardnerella vaginalis. GN=AC069_06915 OC=Gardnerella.
Sequence
MEPLKRCVVLAAGDYYDHTREHVPDRALTIAADGGWDHACRLGLHVDALIGDFDSVRLKL
PTDAAITRLPAEKDDPDLLSALKVGWAKGSREFHIFGGLGGRVDHTISNIQLMVRLAVRG
GIGFLYGDGTIVTAIHNGSLDFPASNGHEGRMVSVFSHTPVSSDVNEIGLKYQLQHATMY
GDAVQGLSNELLNDTPAHIDVHEGTLVITFPIDAPLPQVSWFKRPVGDLGDINTSISSAL
AVPSK
Download sequence
Identical sequences A0A0J8I3M5 E3D779 F5LUD1 I4LG22 S4GWS4 S4HGC4 S4I283 S4IEH8
gi|385801329|ref|YP_005837732.1| gi|311115051|ref|YP_003986272.1| WP_004112993.1.13219 WP_004112993.1.17174 WP_004112993.1.18986 WP_004112993.1.22581 WP_004112993.1.25959 WP_004112993.1.37582 WP_004112993.1.63619 WP_004112993.1.64226 WP_004112993.1.65553 WP_004112993.1.67634 WP_004112993.1.87533 WP_004112993.1.90601 WP_004112993.1.92662 WP_004112993.1.94975 YP_003986272.1.51309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]