SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8JFU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8JFU1
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000562
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8JFU1
Sequence length 144
Comment (tr|A0A0J8JFU1|A0A0J8JFU1_9LIST) Uncharacterized protein {ECO:0000313|EMBL:KMT63246.1} KW=Complete proteome OX=1497681 OS=Listeria newyorkensis. GN=X559_0382 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MEYNFLKINKENKFYPVTIESIEQAQADLGFKFPQELIDCYTNLGYGFIKGSRQNVNRLM
DPLSVRDFKLKQNDFEFFPDIELYNDLEDELIFFEANETAMISIKLVDSESSAIYYDEFK
IANSLAEFLQKIAVDDMYYMDLVD
Download sequence
Identical sequences A0A0J8JFU1
WP_059140524.1.21322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]