SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8Q2H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8Q2H0
Domain Number 1 Region: 22-75,127-189
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000353
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8Q2H0
Sequence length 195
Comment (tr|A0A0J8Q2H0|A0A0J8Q2H0_STEMA) Protein involved in beta-1,3-glucan synthesis {ECO:0000313|EMBL:KMU66275.1} KW=Complete proteome OX=40324 OS=maltophilia). GN=STRNTR1_1523 OC=Stenotrophomonas maltophilia group.
Sequence
MNLVDRFLSGLVPRLPADDAAQWAWIQGASAEDLQRLRAQWPQVPDSLMELLSRVDGTHF
REYPGGEVCVLMLGSDVGDYPYYLRSVAQIFEDQQQWDDSIRSIYEEWLDDEPDILGAGI
DADLPMNRRLCFSHCMNNGGTSMLYLDFDPAPGGTVGQVVRYLHDPDSYVVIAPSFDAYL
QQLIDGDYAFIDEEQ
Download sequence
Identical sequences A0A0J8Q2H0
WP_049443878.1.12888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]