SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8RB88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8RB88
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000471
Family Preprotein translocase SecE subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RB88
Sequence length 70
Comment (tr|A0A0J8RB88|A0A0J8RB88_COCIT) Uncharacterized protein {ECO:0000313|EMBL:KMU81670.1} KW=Complete proteome; Reference proteome OX=454286 OS=Coccidioides immitis RMSCC 3703. GN=CISG_02688 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MSETFQELADIPKDFVKDGMLFVNRCTKPDKREFLKISQAVGFGFLIMGAIGYFIKLIHI
PVNNILVGGA
Download sequence
Identical sequences A0A0J6FB66 A0A0J6Y0Z6 A0A0J8RB88 A0A0J8RGY3 C5PIV0 E9D4L7 J3KGW7
CIHT_02225 CIRT_00385 CPSG_05135T0 CPAT_02523 222929.C5PIV0 CIMG_00384T0 XP_001246613.1.59393 XP_003066598.1.1890 CIST_02698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]