SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8RFP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J8RFP4
Domain Number - Region: 64-94
Classification Level Classification E-value
Superfamily A heparin-binding domain 0.0196
Family A heparin-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RFP4
Sequence length 111
Comment (tr|A0A0J8RFP4|A0A0J8RFP4_COCIT) Uncharacterized protein {ECO:0000313|EMBL:KMU84025.1} KW=Complete proteome; Reference proteome OX=396776 OS=Coccidioides immitis H538.4. GN=CIHG_01809 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MSFVQRVFATIRAAIVPPNKRGTAGLAIFVLEYQSLDLSPPPGICYTGPTVRIPTHAAAC
HEKRAIVCGLNIAHPPAEAGGWVAQCTEKRTCGESRGYAVVHNGIGAHGLV
Download sequence
Identical sequences A0A0J6YH97 A0A0J8R7A9 A0A0J8RFP4
CIST_02198 CIHT_01817 CIRT_06135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]