SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8RI55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J8RI55
Domain Number - Region: 28-58
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0837
Family Trimerization domain of TRAF 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RI55
Sequence length 168
Comment (tr|A0A0J8RI55|A0A0J8RI55_COCIT) Uncharacterized protein {ECO:0000313|EMBL:KMU84567.1} KW=Complete proteome; Reference proteome OX=396776 OS=Coccidioides immitis H538.4. GN=CIHG_02351 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MEREVRSAVRAAFSDLQDSYLRQEFRTIHGRLARADGHFLAIDSRFAAMDARFQTVESST
ATKESYTFANEFFSCRHTTSGHLGVDCDAIHDRVTRLEFQQRKNLGVKRSLEGSNSLRKQ
ALRALGSGSKPEQAEAENLSPSSRHTILCWEHRSEVLDNLSISKERVQ
Download sequence
Identical sequences A0A0J8RI55
CIHT_02362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]