SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8RV58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8RV58
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 2.09e-38
Family Dom34/Pelota N-terminal domain-like 0.00076
Further Details:      
 
Domain Number 2 Region: 148-250
Classification Level Classification E-value
Superfamily Translational machinery components 1.18e-16
Family ERF1/Dom34 middle domain-like 0.0033
Further Details:      
 
Domain Number 3 Region: 252-328
Classification Level Classification E-value
Superfamily L30e-like 0.00000000000000288
Family ERF1/Dom34 C-terminal domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RV58
Sequence length 343
Comment (tr|A0A0J8RV58|A0A0J8RV58_COCIT) CGI-17 protein {ECO:0000313|EMBL:KMU89065.1} KW=Complete proteome; Reference proteome OX=396776 OS=Coccidioides immitis H538.4. GN=CIHG_06867 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MRLIKQNIEQDGSGSVTLFPEEPEDMWHAYNLIRPHDLLKASAIRRVTTTATTGTTSSSR
VHLTLQIRVKSLDFDPQSSQLHVSGQIASENPYTKIGQHHTLDLELQRNFTLEKRTESGE
VGGWDSVAIEMLKDAVDEGYKRRAEAVAALAKFFQVTLETLLRLLDTSAGSITSSTTSNG
TSTRPILLASPGFTAVSFQKHIQSVSLGKPELKPLLESMIVVHSSSGHVHSLAEVLKSPS
VQARLSNTKYAQSAVEQGAVGRGGGILLISNRLFRAQDVHERKRWVSLVDRVRDVEGGEV
RVLSSDHESGKRLDGLGGVAALLTFPVLDDENEEDDGDDNADG
Download sequence
Identical sequences A0A0J8RV58
CIHT_06899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]