SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9FCG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9FCG2
Domain Number 1 Region: 65-204
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.76e-22
Family SMI1/KNR4-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9FCG2
Sequence length 222
Comment (tr|A0A0J9FCG2|A0A0J9FCG2_9BACE) Uncharacterized protein {ECO:0000313|EMBL:KMW76002.1} KW=Complete proteome OX=457389 OS=Bacteroides sp. 3_1_13. GN=HMPREF9009_03918 OC=Bacteroides.
Sequence
MEEVIRKYVDECWGFVQEHREYLMYVPSYEEHIEPEMQDTFDNIIPQGKSVKIYVTQPEH
TNYMVDIITEKDHVWKAIDNQISDEDISKLESKLNVILPLSYKIYLKYKHFYEIFWDLDV
RLYPKPIHSWNKILIENNEELQEEILNKGYFAIGRYSDYGVIALKLTDDENKEGEILLFD
YETPETEVLAPNFIEFLNQILQNPKPVLQELKGWEKKMYKME
Download sequence
Identical sequences A0A0J9FCG2 A0A174D364 D6CWW7
WP_015531590.1.31445 WP_015531590.1.4322 WP_015531590.1.610 WP_015531590.1.72775 WP_015531590.1.73642 gi|479163516|ref|YP_007792250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]