SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9SCF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9SCF9
Domain Number 1 Region: 3445-3485
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9SCF9
Sequence length 3488
Comment (tr|A0A0J9SCF9|A0A0J9SCF9_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ80620.1} KW=Complete proteome OX=1077284 OS=Plasmodium vivax India VII. GN=PVIIG_04405 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNNNFNINVQVDSAFLSEHEVEVNGYFAKLYTGEITVDTMIEIMKSLSCCPKGSKNNDVY
KSMLLILFNECRFFPKYPSEELDTTAQLFGKLVKHNLLLSYGNTLAVALRCILEALKKGN
DSKMFIFGITALEQFEDSLICYPSFLSSLIELTTLRQYNLQYVIHCSNLLSTLPEHFRSL
PYIDASTILKIKHLAEIGANSSTTDANMSQASNEDLRKISPHNAHNLKNVNNLISSMGIA
MGSGLVENANVNNNLSAASSCSSNNNNSALANALSSMLKANSANLTSDNVLSYISDLLPN
NSSLLHHHPHLQASQHVNLQASQHVNLQASQHVNLQANLQASQHVNLQANLQASQHINPH
ANLQANLQASQHINPHASQHINLQPSQHINPHASPHTLGRTDHLFKNKNISDNLNSNYNV
NINSFSSPVKNQNITSNVNLLNGDKLSTPFGASNQLYANRSYVPPNGSNQMNRVLTAQGN
QFNLGGREIVSLSNASILNDHAGEIGVSSMVDASKYASTPEGIKRPNVNLGGDKGDGIGM
SSSVGIGNNLASGNPLSSRDKEEQLCQMMESFYDRVQVKLPPNLSLNNIGGFGLGQIECL
MDNTELTKNIIVPSSLIIGEVFSIFNTLCSFNIDEKIKILKEVMQPEHYSWLAFYIVKSR
ASKEVNLHEVFLEFIDKLSYPMLIDTIINMTYDCILILFKYINELKEVSAFKTVLKNLGS
WLGFITLGRNRPLKSKILDLKLVLFEAYEKGCLVCILPMVCRILESIKLSKNFKPPNPWT
TTMLCLLTEIHELPNVKTYTIFEVEILFKNLALDIHAFQNKTTLLSKRSVAQNRKSELLI
PKGGNNNQESSTALPVSEDLKNLPRREGLTSAINTHMGRVEGALTMNHRMEEFENAAKIT
AREIPSSVPNNARPSTRFIPEKVEYTRRNNNLPSYNADYVDSEWSKDDGERIDALTNDMT
LVSTFSPPDISLINASYHKKVAGSGGKNVNAMGEQYAPSVSYATGANYDASATYEGSSIH
PRNANYDGSASHLGNANYYDSNAEYYENGAQYYDGAANYDGAANYDGAANYDGTAAYYDS
NDNMDIPDISIDNNLINNKINSSKFLQSLNSAVIISPSIALFQIQPGLKSLVTIAFYQAI
REIIAAILDRSVAISCVTTREIVCKDFCLERDETLIRKAAHIMISSLAGSLALVTCKEPL
RISLTHHLRHWLEKTSTKDCNDQVLIEQVVQILSADNLELGCSLVEQAVIEKAIKDINEA
LEPTFVARQVAKENRIALHDPIHLMNTKRMQLEIAHYLKLGSPITNNQLQVYKDFLNIAP
LKKLHAAAKALTKVYKNVNDVNDVNDVNLESNQQSGGTLMHALFSSSNLQKKEEKIDYPK
SMNEEKRIANEPPNGMPKGDPKVVRKTHTDYNPNGGIKTEQSVSSAKRNANENSSPSPQP
SSPSAAPQATNSQLHKILNKLELATNQLKDAVKDILILPPILFNINKEKPSDNVNKMSLH
ILYSLSVDGSIFNLIKSIPEIAALTQHKNETIISYSNRIYKFLFEIIPPNSNRTPWVYRS
NDPSGIYLEVFLCILEKLKKKCPLLREHITDFIMSDDSSTLSNDNSPSCSKRLFSASNLL
KEKESDDVAKMGSEFSSPTNSNSNLDGHQNKNESEVKSHNRGAPKMNANVIAGFIRYNLV
NMQKYKYYLVRQLSTDMYSVNSNVEFVILLLRKILIDFHIFRYKDFESIFIILNNLKEQN
ILTKKVFFFNDSPPIDINVAIELLTEEAKKIQGKKDAVIFSDLLHVYEEYLKSDDERNVR
DGSDQHAVPRGAYTDQTMLRIGMDRSATDAEAKKGQPPGSQVQNGRNWQHAQGESGSRGD
DGSYYSSETLKGRETNGSTFDLKCARTNNNFHLNELKKSELLKNPLEYFKRDYNQLSEDL
LSALIEEQHFDKIQDELKSVDNFGLLDMEGVKVHTVEDVRLREKGEKEKSALSTRTSTNN
KSNIDGIAINQMNQENRANAHICHSKRQAKREYKKNLKILMDPEYITTLTQIIDFCLNTD
WNILQKRKNNKYFKDKGVGGIRVVPKPQKIPKQHEQIISIFFFQWIKLINLKNVENPNQS
YVKFFQNISNQGLLRIDNNTDNFFAVCIYKAVEGGTSISTVNSSGHIVERGKTTNVLDKA
HTANGNRGSNYPGGAIYGQQNGDSSLTSQKREFANGGSDPIQGGPIQGDNNNPNGVYPPS
GETKSGGGNEESPHLHRNKAINKNEEDDAQRFDKIGRHAEQTSSDETKEPREKNNNSSSK
CSQASDENRSYIESTNLTFYSNMSNDGHSHSDDEEESCLDSSSRRQRTTKQMQVKKSEML
RNLSSAINGSADVDFASHCENEFDKSETHFEVKRRNGGGSPNEMAVSHLRGSYKHGSGVE
SDEAEEEEEEEETGDTEDTEETEETEDELDEQLDEAEVGVELEADDEIEADVEIEVDGEI
EADVELEADVEIEADGEIEADVELEADDEIEAEEPGEEHHGSDADEEEEDDVVVQSDGEG
ETQIESDEEDETDVEEEEADEADEADEAGEAGETDEEDETEVEDGHHGDRASESYEVEAE
EQQQQLGEGEEEASKEGDEVEASEEAHVEDSQSSGESDDEDVYHYHCDLRDRYACGQPEG
GNQPGGGISTAEQPVRLEGNFHVDDTIDALSLDGLAKMIICMMKLVDTQQISPFILFQKV
MNVFCRIVVKESRRNKRNFNQRPYFRLFLSILVEINKNEKYFEQSYNKLILALGYYLCIL
NPLRIPTFIFAWLELISHKLFLPKILKTSKGWCIYNKLLIYLLEFLYVFLKNAYLTPPIK
IIYRGTLRMLLILLHDFPEFLCVYNFSFCNSIPLNCVQLRNLILSAFPRNLKLPHPFYPN
LKVDLLPEMKVVPVILNNFTFILIDYNIKKDVDDYFVSRNVTCLKKMHQKLLIRNKMKAL
YLKTKYNIALINALVLYIGMSLPSQILMIDKVSESHPALEIILHLTYRLDMEGRYYLLSS
IANHLRYPNAHTHYFSCLLLWIFNISKMEVVNEQITGILLERLIVHRPHPWGLLITFIEL
IKNPIFKFWQCSFVHVNPEIEKLFQSIAHSCLVNQMEHFSGVAAVGAVAAVAADGSAGGV
NAVSAVGPVGPVGGANQGTSSTHTTSDVNPVSARSPPPCNDRSNADLKMYTLPNEPHANK
IMPNSHHHNQGSSTSSSITNRYTQKHEHSANGSIAMNNHFAHGSNDDLFRNAMSGDHLNG
YAAKGNAYPSVCEQQPARVHPNMLRSHISYNDSSSIDTDNYSLPNNRVAQRNHPLSGYAA
PPHVAAESNNRNDFYHPQNLHHLLAKSNKALDIDGQSDFGEMQRGVPNGSLSANDSGRSA
APPVRGIHGTMGSGTNVGFHGGFHPNRNLISTNVSLNSRNHSVESLINLTNYGDLKNVSI
LLPPHLIMENTNPFEFKKVDKLNLDKYNVPPFFEEILSEFIAKLVKTHPDNAYLFALNYF
DDKLKEHH
Download sequence
Identical sequences A0A0J9SCF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]