SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9SDL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9SDL9
Domain Number 1 Region: 182-329
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 1.7e-53
Family Functional domain of the splicing factor Prp18 0.00018
Further Details:      
 
Domain Number 2 Region: 73-126
Classification Level Classification E-value
Superfamily PRP4-like 0.00000000000109
Family PRP4-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9SDL9
Sequence length 342
Comment (tr|A0A0J9SDL9|A0A0J9SDL9_PLAVI) Pre-mRNA splicing factor protein {ECO:0000313|EMBL:KMZ81054.1} KW=Complete proteome OX=1077284 OS=Plasmodium vivax India VII. GN=PVIIG_02536 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDSLDSFIKKKKEEIKEIKGNKRWFKQAELESKKKTEINKFYENEYKKKKTEEYERLKKL
NDELDAKRRKHSVDVEHEETNTEITLTNRQIIILLRQLKEPIRLFGETDLERYNRLKELK
INKNELKINVQNVFGDVLRGKLKENSLDLIEDNLEDDIDNANSKESAELNGPTAEKKSDE
KGQGVDKEGVILDWIKSTMKEWNEEIENSDDGKKKIKKATYLQTHKDLKPLEKKLKQKSL
EADVLDKIYNIVSRCQERNFKAAHDAYMLLAIGNAAWPMGVTMVGIHERAGRSKIFASEV
AHILNDETTRKYIQMIKRLLSFCQRKYCTNPSEAVNLSTIHI
Download sequence
Identical sequences A0A0J9SDL9 A0A0J9SYS2 A0A0J9TG13 A0A0J9TY90 A0A1G4GVD0 A5K6U1
gb|PVX_099545 5855.PVX_099545 gi|156097452|ref|XP_001614759.1| XP_001614759.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]