SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9SP60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9SP60
Domain Number 1 Region: 38-187
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.41e-24
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.054
Further Details:      
 
Domain Number 2 Region: 176-339
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 9.16e-17
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9SP60
Sequence length 377
Comment (tr|A0A0J9SP60|A0A0J9SP60_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ84586.1} KW=Complete proteome OX=1033975 OS=Plasmodium vivax Brazil I. GN=PVBG_00366 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNSNKENGRPFTSLPNGPQPKHKLNHIVLTDQFVNREKLKKEILDTHKKLTADSFIDKRK
EEIYFLLKSAIMPNLKGKIYFVGSCENHIWIKNSDIDCCIVVENCEDKNSYLYILKVIKS
AINLIYPSLTVNIIKASVPIAKIYREQNNICDISINNTVAIVNTKLVSSLCNTDERVTII
NRVIKYWAKQKNINNRSQGTFSSYALFLLTYYFLQNLETPLLPPYKSIERENASSFEINS
EYFFLQDDVEMPFYTDAGDIKSKLDTPRKNEDDVSKLLYGSSCRNGITLDVYNNQIIENK
DMTANIFCPITKRIVNTYSINTWKKMFQKILAAHERLKGGKSLDVICEETKNTTPNRKID
LKDHLLRRKIFQGLHEP
Download sequence
Identical sequences A0A0J9SP60 A0A0J9T442 A0A0J9TPL0 A5K8J3
gb|PVX_100595 gi|156095663|ref|XP_001613866.1| XP_001613866.1.43797 5855.PVX_100595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]