SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9SX01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9SX01
Domain Number 1 Region: 99-186
Classification Level Classification E-value
Superfamily GINS helical bundle-like 0.000000785
Family PSF2 C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9SX01
Sequence length 207
Comment (tr|A0A0J9SX01|A0A0J9SX01_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ87359.1} KW=Complete proteome OX=1033975 OS=Plasmodium vivax Brazil I. GN=PVBG_04068 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNEEIEKNIKLNSNFIEFEEIIKDINTPFSFIDLVEIPCVPLVDIYGLSLLSNEAYLEYK
NGLREDKLNAEDEIRLTLFFAVKLYKKNVIKIKFPSYYDIIETLKFDPVSVTIGLFNQFY
FETAYELCNLLPVNEWPSTNFYDILRKAEKTRIHFLINNKTKLNSYFLEGLTNKEKKIYK
YFLEGTSKERESMNRETTLFYFYEKDK
Download sequence
Identical sequences A0A0J9SFM8 A0A0J9SX01 A0A0J9TFJ4 A0A0J9WEB1 A0A1G4GV45 A5K6L5
gb|PVX_099165 XP_001614683.1.43797 gi|156097300|ref|XP_001614683.1| 5855.PVX_099165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]