SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9T8W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J9T8W9
Domain Number - Region: 14-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9T8W9
Sequence length 127
Comment (tr|A0A0J9T8W9|A0A0J9T8W9_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ91554.1} KW=Complete proteome OX=1035515 OS=Plasmodium vivax Mauritania I. GN=PVMG_00427 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MPFPCHKHFVDDLEYIKSKNIAEIFEGLLGYVYFEKPQNVVESLIGELKKLEKKNNVKKV
FDAEDIKAVYNFLNLQNEKCISREKCILGLSQFVLNNKQREFMESAKISSDVDLEVFTSY
AEKIINM
Download sequence
Identical sequences A0A0J9S7M4 A0A0J9SPQ1 A0A0J9T8W9 A0A0J9TTD8 A5K3A8
gi|156100023|ref|XP_001615739.1| XP_001615739.1.43797 gb|PVX_117220 5855.PVX_117220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]