SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9TY82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9TY82
Domain Number 1 Region: 3442-3482
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9TY82
Sequence length 3485
Comment (tr|A0A0J9TY82|A0A0J9TY82_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ99802.1} KW=Complete proteome OX=1035514 OS=Plasmodium vivax North Korean. GN=PVNG_04447 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNNNFNINVQVDSAFLSEHEVEVNGYFAKLYTGEITVDTMIEIMKSLSCCPKGSKNNDVY
KSMLLILFNECRFFPKYPSEELDTTAQLFGKLVKHNLLLSYGNTLAVALRCILEALKKGN
DSKMFIFGITALEQFEDSLICYPSFLSSLIELTTLRQYNLQYVIHCSNLLSTLPEHFRSL
PYIDASTILKIKHLAEIGANSSTTDANMSQASNEDLRKISPHNAHNLKNVNNLISSMGIA
MGSGLVENANVNNNLSAASSCSSNNNNSALANALSSMLKANSANLTSDNVLSYISDLLPN
NSSLLHHHPHLQASQHVNLQANLQANLQASQHINPHANLQANLQASQHINPHASQHINLQ
PSQHINPHASPHTLGRTDHLFKNKNISDNLNSNYNVNINSFSSPVKNQNITSNVNLLNGD
KLSTPFGASNQLYANRSYVPPNGSNQMNRVLTAQGNQFNLGGREIVSLSNASILNDHAGE
IGVSSMVDASKYASTPEGIKRPNVNLGGDKGDGIGMSSSVGIGNNLASGNPLSSRDKEEQ
LCQMMESFYDRVQVKLPPNLSLNNIGGFGLGQIECLMDNTELTKNIIVPSSLIIGEVFSI
FNTLCSFNIDEKIKILKEVMQPEHYSWLAFYIVKSRASKEVNLHEVFLEFIDKLSYPMLI
DTIINMTYDCILILFKYINELKEVSAFKTVLKNLGSWLGFITLGRNRPLKSKILDLKLVL
FEAYEKGCLVCILPMVCRILESIKLSKNFKPPNPWTTTMLCLLTEIHELPNVKTYTIFEV
EILFKNLALDIHAFQNKTTLLSKRSVAQNRKSELLIPKGGNNNQESSTALPVSEDLKNLP
RREGLTSAINTHMGRVEGALTMNHRMEEFENAAKITAREIPSSVPNNARPSTRFIPEKVE
YTRRNNNLPSYNADYVDSEWSKDDGERIDALTNDMTLVSTFSPPDISLINASYHKKVAGS
GGKNVNAMGEQYAPSVSYATGANYDASATYEGSSIHPRNANYDGSASHLGNANYYDSNAE
YYENGAEYYDGAANYDGAANYDGAANYDGAANYDGAANYDGTAAYYDSNDNMDIPDISID
NNLINNKINSSKFLQSLNSAVIISPSIALFQIQPGLKSLVTIAFYQAIREIIAAILDRSV
AISCVTTREIVCKDFCLERDETLIRKAAHIMISSLAGSLALVTCKEPLRISLTHHLRHWL
EKTSTKDCNDQVLIEQVVQILSADNLELGCSLVEQAVIEKAIKDINEALEPTFVARQVAK
ENRIALHDPIHLMNTKRMQLEIAYYLKLGSPITNNQLQVYKDFLNIAPLKKLHAAAKALT
KVYKNVNDVNDVNDVNLESNQQSGGTLMHALFSSSNLQKKEEKIDYPKSMNEEKRIANEP
PNGMPKGDPKVVRKTHTDYNPNGGIKTEQSVSSAKRNANENSSPSPQPSSPSAAPQATNS
QLHKILNKLELATNQLKDAVKDILILPPILFNINKEKPSDNVNKMSLHILYSLSVDGSIF
NLIKSIPEIAALTQHKNETIISYSNRIYKFLFEIIPPNSNRTPWVYRSNDPSGIYLEVFL
CILEKLKKKCPLLREHITDFIMSDDSSTLSNDNSPSCSKRLFSASNLLKEKESDDVAKMG
SEFSSPTNSNSNLDGHQNKNESEVKSHNRGAPKMNANVIAGFIRYNLVNMQKYKYYLVRQ
LSTDMYSVNSNVEFVILLLRKILIDFHIFRYKDFESIFIILNNLKEQNILTKKVFFFNDS
PPIDINVAIELLTEEAKKIQGKKDAVIFSDLLHVYEEYLKSDDERNVSDGRDQHAVPRGA
YTDQTMLRIGMDRSATDAEAKKGQPPGSQVQNGRNWQHAQGEGGSRGDDGSYYSSETLKG
RETNGSTFDLKCARTNNNFHLNELKKSELLKNPLEYFKRDYNQLSEDLLSALIEEQHFDK
IQDELKSVDNFGLLDMEGVKVHTVEDVRLREKGEKEKSALSTRTSTNNKSNIDGIAINQM
NQENRANAHICHSKRQAKREYKKNLKILMDPEYITTLTQIIDFCLNTDWNILQKRKNNKY
FKDKGVGGIRVVPKPQKIPKQHEQIISIFFFQWIKLINLKNVENPNQSYVKFFQNISNQG
LLRIDNNTDNFFAVCIYKAVEGGTSISTVNSSGHIVERGKTTNVLDKAHTANGNRGSNYP
GGAIYGQQNGDSSLTSQKREFANGGRDPIQGGPIQGGPIQGDNNNPNGVYPPSGETKSGG
GNEESPHLHRNKAINKNEEDDAQRFDKIGRHAEQTSSDETKEPREKNNNSSSKCSQASDE
NRSYIESTNLTFYSNMSNDGHSHSDDEEESCLDSSSRRQRTTKQMQVKKSEMLRNLSSAI
NGSADVDFASHCENEFDKSETHFEVKRRNGGGSPNEMAVSHLRGSYKHGSGVESDEAEEE
EEEEETGDTEDSEETEETEDELDEQLDEAEVGVELEADDEIEADDEIEADVEIEADGEIE
ADVELEADGEIEADVELEADDEIEAEEPGEEHHGSDADEEEEDDEEDDVVVQSDGEGETQ
IESDEEDETDVEEEEADEADEADEAGEAGETDEEDETEVEDGHHGDRASESYEVEAEEQQ
QQLGEGEEEASKEGDEVEASEEAHVEDSQSSGESDDEDVYHYHCDLRDRYACGQPEGGNQ
PGGGISTAEQPVRLEGNFHVDDTIDALSLDGLAKMIICMMKLVDTQQISPFILFQKVMNV
FCRIVVKESRRNKRNFNQRPYFRLFLSILVEINKNEKYFEQSYNKLILALGYYLCILNPL
RIPTFIFAWLELISHKLFLPKILKTSKGWCIYNKLLIYLLEFLYVFLKNAYLTPPIKIIY
RGTLRMLLILLHDFPEFLCVYNFSFCNSIPLNCVQLRNLILSAFPRNLKLPHPFYPNLKV
DLLPEMKVVPVILNNFTFILIDYNIKKDVDDYFVSRNVTCLKKMHQKLLIRNKMKALYLK
TKYNIALINALVLYIGMSLPSQILMIDKVSESHPALEIILHLTYRLDMEGRYYLLSSIAN
HLRYPNAHTHYFSCLLLWIFNISKMEVVNEQITGILLERLIVHRPHPWGLLITFIELIKN
PIFKFWQCSFVHVNPEIEKLFQSIAHSCLVNQMEHFSGVAAVGAVGAVAADGSAGGVNAV
SAVGPVGPVGGANQGTSSTHTTSDVNPVSARSPPPCNDRSNADLKMYTLPNEPHANKIMP
NSHHHNQGSSTSSSITNRYTQKHEHSANGSIAMNNHFAHGSNDDLFRNAMSGDHLNGYAA
KGNAYPSVCEQQPARVHPNMLRSHISYNDSSSIDTDNYSLPNNRVAQRNHPLSGYAAPPH
VAAESNNRNDFYHPQNLHHLLAKSNKALDIDGQSDFGEMQRGVPNGSLSANDSGRSAAPP
VRGIHGTMGSGTNVGFHGGFHPNRNLISTNVSLNSRNHSVESLINLTNYADLKNVSILLP
PHLIMENTNPFEFKKVDKLNLDKYNVPPFFEEILSEFIAKLVKTHPDNAYLFALNYFDDK
LKEHH
Download sequence
Identical sequences A0A0J9TY82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]