SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9UM18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9UM18
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000353
Family Txnl5-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9UM18
Sequence length 129
Comment (tr|A0A0J9UM18|A0A0J9UM18_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNB00270.1} OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_03880 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MPILNDVRLSSPEDLVPLARSDEPIYVILTSSNDEETGAPWCSDVRAALPFLKETFDKPE
GPKAIYESVGPRPGWKKPDNPHKLTWNISAIPTVIRFELRDGKIEETGRLTEVEVYEEGK
LQNFVLKSV
Download sequence
Identical sequences A0A0J9UM18
XP_018238315.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]