SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9VRS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J9VRS9
Domain Number - Region: 19-47
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0248
Family Chemosensory protein Csp2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9VRS9
Sequence length 104
Comment (tr|A0A0J9VRS9|A0A0J9VRS9_FUSO4) 40S ribosomal protein S26 {ECO:0000256|RuleBase:RU363128} OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_12885 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFA
EYTVPKMYLKLQYCVSCAIHGKIVRYVVLPGSVTTAPWLRMCFR
Download sequence
Identical sequences A0A0J9VRS9 W9HUQ4 W9JMH1 W9P3D5 X0A2C6 X0CPT2 X0J443 X0JVX5 X0LLL7
XP_018251410.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]