SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9WE92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9WE92
Domain Number 1 Region: 74-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000855
Family Nucleotide and nucleoside kinases 0.0061
Further Details:      
 
Weak hits

Sequence:  A0A0J9WE92
Domain Number - Region: 15-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00201
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9WE92
Sequence length 219
Comment (tr|A0A0J9WE92|A0A0J9WE92_PLAVI) Adenylate kinase {ECO:0000313|EMBL:KNA00254.1} KW=Complete proteome OX=1035514 OS=Plasmodium vivax North Korean. GN=PVNG_04304 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
METLLDSETLKNYEKETNEYIRKKKVEKLFDVILKNVLVNKPENVYLYIYKNIYSFLLNK
IFVIGPPLLKITPTLCSAIASCFSYYHLSASHMIESYTTGEVDDAAESSTSKKLVSDDLI
CSIVKSNINQLNAKQKRGYVVEGFPGTNLQADSCLRHLPSYVFVLYADEEYIYDKYEQEN
NVKIRSDMNSQTFDENTQLFEVAEFNTNPLKDEVKVYLR
Download sequence
Identical sequences A0A0J9SDW6 A0A0J9SWQ3 A0A0J9TEN4 A0A0J9WE92 A5KEC3
XP_001608365.1.43797 gb|PVX_087110 gi|156081744|ref|XP_001608365.1| 5855.PVX_087110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]