SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9WNY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9WNY7
Domain Number 1 Region: 84-136
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 0.0000000708
Family Purine and uridine phosphorylases 0.01
Further Details:      
 
Domain Number 2 Region: 137-217
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000109
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9WNY7
Sequence length 319
Comment (tr|A0A0J9WNY7|A0A0J9WNY7_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNB08102.1} OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_09101 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MWQENTETGVSVHWIIESATSVSVDRCGILEADYEGQGHELNERIEKALSKRPRLRKRYA
RPLRRQHAQITVAKKTSSPDDDDDSMIHYGLIASSDKLMKDATIRDELVREEGALCFEME
AAGLMNHFLCLIIRGIRARNGRALSEACEAGSIEIARLLLSERAKADYKSTELEAWVRSP
SPYNYNELECYTFSECSLVSAAKSGNEHLVQMLLDNVFDLSRVVGLRQESKVITSIYVKK
AFVAALQGCHQRVITTLLDAMVNHTHTDEYATLSAVSEIQTQHILREFSAAIDKEDSPPF
LEIMNHLHEILLGDHKHIF
Download sequence
Identical sequences A0A0J9WNY7
XP_018246147.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]