SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9X8I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9X8I7
Domain Number 1 Region: 170-347
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 1.57e-43
Family Functional domain of the splicing factor Prp18 0.0000836
Further Details:      
 
Domain Number 2 Region: 115-163
Classification Level Classification E-value
Superfamily PRP4-like 0.0000000235
Family PRP4-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9X8I7
Sequence length 353
Comment (tr|A0A0J9X8I7|A0A0J9X8I7_GEOCN) Similar to Saccharomyces cerevisiae YGR006W PRP18 Splicing factor {ECO:0000313|EMBL:CDO53515.1} OX=1173061 OS=Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum). GN=BN980_GECA05s02848g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Galactomyces.
Sequence
MDFSALLAKEIAKKKSIANKAATSTSAPSTKATSAGLGNTKKKYLTKAQLEQAELELQAE
KQRELDEAREQAVQARKRRVDEERAANERKRQKLEEKRRESQREREARDRASQDQAKVEG
LEESKLTDEELTKEFRARGEPVTLFAERRSQRVLRLHELNQQAKRKEQEQQEEELERTIN
MEISEPDIKTDSDKVYTQMRATIRTLLAEWRNIITAPDQDATADNKEALEVLAQTEAYCQ
PLLQQLRQKALPKQLYPKLATLLMHIQQHRYREANDVYIQMSIGNAAWPIGVTAVGIHAR
SARERITGYGNENDENVQVAHIMSDDATRKWLIAIKRFITFAEGHLSKKSFKS
Download sequence
Identical sequences A0A0J9X8I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]