SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9XV46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9XV46
Domain Number 1 Region: 22-95
Classification Level Classification E-value
Superfamily SEA domain 0.0000000262
Family SEA domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9XV46
Sequence length 134
Comment (tr|A0A0J9XV46|A0A0J9XV46_BRUMA) Bm9911, isoform a {ECO:0000313|EMBL:CDP95892.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm9911 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MSKMQAVSSTSFHTLRRLEGHFLVTEGPLLKFDGKLLQKNTDQFIIHASKIQRQLNHIYR
QSGCRLIYVGAEVTKFRFVPTVPALDVTFILKIRSDLNIDVFNFLSILRNYVRARGFDGN
AIDDKSISLEIKRF
Download sequence
Identical sequences A0A0J9XV46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]